Loading...
Statistics
Advertisement

Hosting & Webhosting von green.ch
www.a2h.ch/
green.ch, der Schweizer Webhoster, bietet preiswertes Web Hosting Angebot für Private, KMUs oder Vermittlungspartner.

A2h.ch

Advertisement
Conversion Technology Metas Server
A2h.ch is hosted in Switzerland / Brugg . A2h.ch doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/8.5.

Technologies in use by A2h.ch

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Server Type

  • Microsoft-IIS/8.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - A2h.ch

Missing HTTPS protocol.

    Meta - A2h.ch

    Number of occurences: 10
    • Name:
      Content: IE=100
    • Name: DESCRIPTION
      Content: green.ch, der Schweizer Webhoster, bietet preiswertes Web Hosting Angebot für Private, KMUs oder Vermittlungspartner.
    • Name: KEYWORDS
      Content: hosting, web hosting, webhoster, webhosting
    • Name: COPYRIGHT
      Content: Copyright 2011 by green.ch
    • Name: AUTHOR
      Content: green.ch
    • Name: RESOURCE-TYPE
      Content: DOCUMENT
    • Name: DISTRIBUTION
      Content: GLOBAL
    • Name: ROBOTS
      Content: INDEX, FOLLOW
    • Name: REVISIT-AFTER
      Content: 1 DAYS
    • Name: RATING
      Content: GENERAL

    Server / Hosting

    • IP: 81.221.254.6
    • Latitude: 47.48
    • Longitude: 8.21
    • Country: Switzerland
    • City: Brugg

    Rname

    • dns1.agrinet.ch
    • dns2.agrinet.ch
    • mail.mail-ch.ch

    Target

    • domreg.agrinet.ch

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Last-Modified: Tue, 07 Jan 2014 08:10:30 GMT Accept-Ranges: bytes ETag: "6ade67ee7fbcf1:0" Server: Microsoft-IIS/8.5 X-Powered-By: ASP.NET Date: Tue, 16 Aug 2016 21:51:35 GMT Content-Length: 3437 X-Cache: MISS from s_fl343 X-Cache-Lookup: MISS from s_fl343:80 Via: 1.1 s_fl343 (squid/3.5.9) Connection: keep-alive

    DNS

    host: a2h.ch
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns1.agrinet.ch
    host: a2h.ch
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns2.agrinet.ch
    host: a2h.ch
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: dns1.agrinet.ch
    5. rname: domreg.agrinet.ch
    6. serial: 2014010712
    7. refresh: 3600
    8. retry: 3600
    9. expire: 777600
    10. minimum-ttl: 3600
    host: a2h.ch
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mail.mail-ch.ch

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.2h.ch, www.ao2h.ch, www.o2h.ch, www.ap2h.ch, www.p2h.ch, www.a92h.ch, www.92h.ch, www.a2h.ch, www.2h.ch, www.ai2h.ch, www.i2h.ch, www.au2h.ch, www.u2h.ch, www.ah.ch, www.a20h.ch, www.a0h.ch, www.a2qh.ch, www.aqh.ch, www.a2wh.ch, www.awh.ch, www.a2.ch, www.a2he.ch, www.a2e.ch, www.a2hd.ch, www.a2d.ch, www.a2hc.ch, www.a2c.ch, www.a2hu.ch, www.a2u.ch, www.a2hj.ch, www.a2j.ch, www.a2h.ch, www.a2.ch, www.a2hb.ch, www.a2b.ch, www.a2hg.ch, www.a2g.ch,

    Other websites we recently analyzed

    1. njchildcustodyexpert.com
      Scottsdale (United States) - 50.63.202.44
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe, Php
    2. clever-mario.INFO
      Germany - 82.165.250.5
      Server software: Apache
      Technology: Html
      Number of meta tags: 3
    3. Softshell jassen voor dames, heren en kinderen | SoftshellWebshop.nl
      Softshell jassen voor dames, heren en kinderen. Ontdek de nieuwe zomercollectie 2016! ✓ Ook grote maten. Koop uw softshell jack online: gratis verzending.
      Netherlands - 5.61.248.217
      Server software: Apache/2
      Technology: CSS, Cufon, Html, Javascript, jQuery Cycle, Zopim Live Chat, Clicky Web Analytics, Google Analytics, Magento
      Number of Javascript: 21
      Number of meta tags: 4
    4. plantspearlsparanoia | Growing Seedlings & Other Thoughts
      Provo (United States) - 173.254.14.138
      Server software: nginx/1.8.1
      Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
      Number of Javascript: 1
      Number of meta tags: 2
    5. designertobuyers.com
      Scottsdale (United States) - 50.63.202.44
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    6. SeaMODE Speed Lab
      Gloucester (United Kingdom) - 213.171.218.7
      G Analytics ID: UA-79673652-1
      Server software: nginx
      Technology: CSS, Html, Javascript, Google Analytics
      Number of meta tags: 1
    7. HostingDiscounter De goedkoopste webhoster van nederland
      HostingDiscounter De goedkoopste webhoster van Nederland - Goedkope domeinnaam registratie, Domein hosting met veel diskspace op uw shared of dedicated server
      Netherlands - 77.95.252.42
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 5
    8. Home | Hoveniersbedrijf Slaats | Hovenier, Deurne, Fred Slaats
      Hoveniersbedrijf uit Neerkant bij Deurne, werkzaam in de gehele regio van Noord-Brabant en Limburg. Onze specialiteit is onderhoud en snoeiwerk.
      Netherlands - 149.210.237.177
      Server software: Apache
      Technology: AJAX Libraries API, CSS, Html, Javascript, Add This
      Number of Javascript: 2
      Number of meta tags: 2
    9. Welcome to Gehlin.Com!
      Sweden - 213.180.93.13
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: CSS, Html
      Number of meta tags: 1
    10. tampacriminaldefenselawyer.net
      Wayne (United States) - 216.250.120.114
      Server software: Apache
      Technology: Html
      Number of meta tags: 1

    Check Other Websites